SCOPe 2.05: Domain d3r7ka2: 3r7k A:249-398

Lineage for d3r7ka2 (3r7k A:249-398)

1. Root: SCOPe 2.05

2. Class a: All alpha proteins [46456] (286 folds)

3. Fold a.29: Bromodomain-like [47363] (15 superfamilies)
   4 helices; bundle; minor mirror variant of up-and-down topology

4. Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families)
   multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel

5. Family a.29.3.0: automated matches [227204] (1 protein)
   not a true family

6. Protein automated matches [226935] (21 species)
   not a true protein

7. Species Mycobacterium abscessus [TaxId:561007] [226109] (2 PDB entries)

8. Domain d3r7ka2: 3r7k A:249-398 [215631]
   Other proteins in same PDB: d3r7ka1, d3r7kb1, d3r7kc1, d3r7kd1
   automated match to d1rx0a1
   complexed with fda, k

Details for d3r7ka2

PDB Entry: 3r7k, 2.5 Å

PDB Description: crystal structure of a probable acyl coa dehydrogenase from mycobacterium abscessus atcc 19977 / dsm 44196

PDB Compounds: (A:) Probable acyl CoA dehydrogenase

SCOPe Domain Sequences for d3r7ka2:

Sequence; same for both SEQRES and ATOM records:

>d3r7ka2 a.29.3.0 (A:249-398) automated matches {Mycobacterium abscessus [TaxId: 561007]}
nsgflqimqqfqaerlgiavqayatagraldlakswareretfgrpltgrqiirhklaem
arqvdvactytravmqrwlagedvvaevsmakntavyacdyvvneavqifggmgymrese
ierhyrdcrilgigggtneimneviakrig

Timeline for d3r7ka2:

• d3r7ka2 first appeared in SCOPe 2.03
  
• d3r7ka2 appears in SCOPe 2.04
  
• d3r7ka2 appears in SCOPe 2.06
  
• d3r7ka2 appears in the current release, SCOPe 2.08