Lineage for d3r7ka2 (3r7k A:249-398)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2706693Fold a.29: Bromodomain-like [47363] (15 superfamilies)
    4 helices; bundle; minor mirror variant of up-and-down topology
  4. 2708344Superfamily a.29.3: Acyl-CoA dehydrogenase C-terminal domain-like [47203] (3 families) (S)
    multidomain flavoprotein; N-terminal domain is all-alpha; the middle domain is open (5,8) barrel
  5. 2708478Family a.29.3.0: automated matches [227204] (1 protein)
    not a true family
  6. 2708479Protein automated matches [226935] (30 species)
    not a true protein
  7. 2708606Species Mycobacterium abscessus [TaxId:561007] [226109] (2 PDB entries)
  8. 2708608Domain d3r7ka2: 3r7k A:249-398 [215631]
    Other proteins in same PDB: d3r7ka1, d3r7kb1, d3r7kc1, d3r7kd1
    automated match to d1rx0a1
    complexed with fda, k

Details for d3r7ka2

PDB Entry: 3r7k (more details), 2.5 Å

PDB Description: crystal structure of a probable acyl coa dehydrogenase from mycobacterium abscessus atcc 19977 / dsm 44196
PDB Compounds: (A:) Probable acyl CoA dehydrogenase

SCOPe Domain Sequences for d3r7ka2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r7ka2 a.29.3.0 (A:249-398) automated matches {Mycobacterium abscessus [TaxId: 561007]}
nsgflqimqqfqaerlgiavqayatagraldlakswareretfgrpltgrqiirhklaem
arqvdvactytravmqrwlagedvvaevsmakntavyacdyvvneavqifggmgymrese
ierhyrdcrilgigggtneimneviakrig

SCOPe Domain Coordinates for d3r7ka2:

Click to download the PDB-style file with coordinates for d3r7ka2.
(The format of our PDB-style files is described here.)

Timeline for d3r7ka2: