Lineage for d1sbbc2 (1sbb C:118-246)

  1. Root: SCOPe 2.01
  2. 929298Class b: All beta proteins [48724] (174 folds)
  3. 929299Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 929300Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 931881Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 935079Protein T-cell antigen receptor [49125] (6 species)
  7. 935181Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries)
  8. 935192Domain d1sbbc2: 1sbb C:118-246 [21563]
    Other proteins in same PDB: d1sbba1, d1sbbb1, d1sbbb2, d1sbbc1, d1sbbd1, d1sbbd2

Details for d1sbbc2

PDB Entry: 1sbb (more details), 2.4 Å

PDB Description: t-cell receptor beta chain complexed with superantigen seb
PDB Compounds: (C:) protein (14.3.d t cell antigen receptor)

SCOPe Domain Sequences for d1sbbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbbc2 b.1.1.2 (C:118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad

SCOPe Domain Coordinates for d1sbbc2:

Click to download the PDB-style file with coordinates for d1sbbc2.
(The format of our PDB-style files is described here.)

Timeline for d1sbbc2: