Lineage for d1sbbc2 (1sbb C:118-246)

  1. Root: SCOP 1.71
  2. 546417Class b: All beta proteins [48724] (149 folds)
  3. 546418Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 546419Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 548299Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 550341Protein T-cell antigen receptor [49125] (6 species)
  7. 550387Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (11 PDB entries)
  8. 550394Domain d1sbbc2: 1sbb C:118-246 [21563]
    Other proteins in same PDB: d1sbba1, d1sbbb1, d1sbbb2, d1sbbc1, d1sbbd1, d1sbbd2
    mutant

Details for d1sbbc2

PDB Entry: 1sbb (more details), 2.4 Å

PDB Description: t-cell receptor beta chain complexed with superantigen seb

SCOP Domain Sequences for d1sbbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1sbbc2 b.1.1.2 (C:118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad

SCOP Domain Coordinates for d1sbbc2:

Click to download the PDB-style file with coordinates for d1sbbc2.
(The format of our PDB-style files is described here.)

Timeline for d1sbbc2: