Class b: All beta proteins [48724] (149 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (25 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (4 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins) |
Protein T-cell antigen receptor [49125] (6 species) |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (11 PDB entries) |
Domain d1sbbc2: 1sbb C:118-246 [21563] Other proteins in same PDB: d1sbba1, d1sbbb1, d1sbbb2, d1sbbc1, d1sbbd1, d1sbbd2 mutant |
PDB Entry: 1sbb (more details), 2.4 Å
SCOP Domain Sequences for d1sbbc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sbbc2 b.1.1.2 (C:118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain} dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgrad
Timeline for d1sbbc2: