Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) |
Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
Protein automated matches [226938] (22 species) not a true protein |
Species Bacillus subtilis [TaxId:1423] [226788] (3 PDB entries) |
Domain d3r7fb2: 3r7f B:144-291 [215626] automated match to d1ml4a2 complexed with cp, po4 |
PDB Entry: 3r7f (more details), 2.1 Å
SCOPe Domain Sequences for d3r7fb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r7fb2 c.78.1.0 (B:144-291) automated matches {Bacillus subtilis [TaxId: 1423]} tfkgltvsihgdikhsrvarsnaevltrlgarvlfsgpsewqdeentfgtyvsmdeaves sdvvmllriqnerhqsavsqegylnkygltveraermkrhaiimhpapvnrgveiddslv eseksrifkqmkngvfirmaviqralqt
Timeline for d3r7fb2:
View in 3D Domains from other chains: (mouse over for more information) d3r7fa1, d3r7fa2, d3r7fc1, d3r7fc2 |