Lineage for d3r7fb1 (3r7f B:1-143)

  1. Root: SCOPe 2.03
  2. 1336837Class c: Alpha and beta proteins (a/b) [51349] (147 folds)
  3. 1386472Fold c.78: ATC-like [53670] (2 superfamilies)
    consists of two similar domains related by pseudo dyad; duplication
    core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134
  4. 1386473Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) (S)
  5. 1386919Family c.78.1.0: automated matches [227206] (1 protein)
    not a true family
  6. 1386920Protein automated matches [226938] (20 species)
    not a true protein
  7. 1386926Species Bacillus subtilis [TaxId:1423] [226788] (3 PDB entries)
  8. 1386929Domain d3r7fb1: 3r7f B:1-143 [215625]
    automated match to d1ml4a1
    complexed with cp, po4

Details for d3r7fb1

PDB Entry: 3r7f (more details), 2.1 Å

PDB Description: crystal structure of cp-bound aspartate transcarbamoylase from bacillus subtilis
PDB Compounds: (B:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3r7fb1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r7fb1 c.78.1.0 (B:1-143) automated matches {Bacillus subtilis [TaxId: 1423]}
mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
gdgcgqhptqslldlmtiyeefn

SCOPe Domain Coordinates for d3r7fb1:

Click to download the PDB-style file with coordinates for d3r7fb1.
(The format of our PDB-style files is described here.)

Timeline for d3r7fb1: