| Class b: All beta proteins [48724] (177 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
| Protein T-cell antigen receptor [49125] (7 species) |
| Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries) |
| Domain d1sbba2: 1sbb A:118-246 [21562] Other proteins in same PDB: d1sbba1, d1sbbb1, d1sbbb2, d1sbbc1, d1sbbd1, d1sbbd2 |
PDB Entry: 1sbb (more details), 2.4 Å
SCOPe Domain Sequences for d1sbba2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1sbba2 b.1.1.2 (A:118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad
Timeline for d1sbba2: