SCOPe 2.05: Domain d3r7da2: 3r7d A:144-291

Lineage for d3r7da2 (3r7d A:144-291)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (22 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [226788] (3 PDB entries)

8. Domain d3r7da2: 3r7d A:144-291 [215617]
   automated match to d1ml4a2
   complexed with po4

Details for d3r7da2

PDB Entry: 3r7d, 2.2 Å

PDB Description: crystal structure of unliganded aspartate transcarbamoylase from bacillus subtilis

PDB Compounds: (A:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3r7da2:

Sequence; same for both SEQRES and ATOM records:

>d3r7da2 c.78.1.0 (A:144-291) automated matches {Bacillus subtilis [TaxId: 1423]}
tfkgltvsihgdikhsrvarsnaevltrlgarvlfsgpsewqdeentfgtyvsmdeaves
sdvvmllriqnerhqsavsqegylnkygltveraermkrhaiimhpapvnrgveiddslv
eseksrifkqmkngvfirmaviqralqt

Timeline for d3r7da2:

• d3r7da2 first appeared in SCOPe 2.03
  
• d3r7da2 appears in SCOPe 2.04
  
• d3r7da2 appears in SCOPe 2.06
  
• d3r7da2 appears in the current release, SCOPe 2.08