| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.78: ATC-like [53670] (2 superfamilies) consists of two similar domains related by pseudo dyad; duplication core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134 |
Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families) ![]() |
| Family c.78.1.0: automated matches [227206] (1 protein) not a true family |
| Protein automated matches [226938] (26 species) not a true protein |
| Species Bacillus subtilis [TaxId:1423] [226788] (3 PDB entries) |
| Domain d3r7da1: 3r7d A:1-143 [215616] automated match to d1ml4a1 complexed with po4 |
PDB Entry: 3r7d (more details), 2.2 Å
SCOPe Domain Sequences for d3r7da1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r7da1 c.78.1.0 (A:1-143) automated matches {Bacillus subtilis [TaxId: 1423]}
mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
gdgcgqhptqslldlmtiyeefn
Timeline for d3r7da1:
View in 3DDomains from other chains: (mouse over for more information) d3r7db1, d3r7db2, d3r7dc1, d3r7dc2 |