SCOPe 2.08: Domain d3r7da1: 3r7d A:1-143

Lineage for d3r7da1 (3r7d A:1-143)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.78: ATC-like [53670] (2 superfamilies)
   consists of two similar domains related by pseudo dyad; duplication
   core: 3 layers, a/b/a, parallel beta-sheet of 4 strands, order 2134

4. Superfamily c.78.1: Aspartate/ornithine carbamoyltransferase [53671] (2 families)

5. Family c.78.1.0: automated matches [227206] (1 protein)
   not a true family

6. Protein automated matches [226938] (26 species)
   not a true protein

7. Species Bacillus subtilis [TaxId:1423] [226788] (3 PDB entries)

8. Domain d3r7da1: 3r7d A:1-143 [215616]
   automated match to d1ml4a1
   complexed with po4

Details for d3r7da1

PDB Entry: 3r7d, 2.2 Å

PDB Description: crystal structure of unliganded aspartate transcarbamoylase from bacillus subtilis

PDB Compounds: (A:) aspartate carbamoyltransferase

SCOPe Domain Sequences for d3r7da1:

Sequence; same for both SEQRES and ATOM records:

>d3r7da1 c.78.1.0 (A:1-143) automated matches {Bacillus subtilis [TaxId: 1423]}
mkhlttmselsteeikdllqtaqelksgktdnqltgkfaanlffepstrtrfsfevaekk
lgmnvlnldgtstsvqkgetlydtirtlesigvdvcvirhsedeyyeelvsqvnipilna
gdgcgqhptqslldlmtiyeefn

Timeline for d3r7da1:

• d3r7da1 first appeared in SCOPe 2.03
  
• d3r7da1 appears in SCOPe 2.07