Lineage for d3r7cc_ (3r7c C:)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2699446Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 2700461Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 2700462Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)
  6. 2700487Protein automated matches [227081] (1 species)
    not a true protein
  7. 2700488Species Norway rat (Rattus norvegicus) [TaxId:10116] [226341] (1 PDB entry)
  8. 2700491Domain d3r7cc_: 3r7c C: [215614]
    automated match to d3tk0a_
    complexed with cd, cl, fad, so4

Details for d3r7cc_

PDB Entry: 3r7c (more details), 2.4 Å

PDB Description: the structure of a hexahestidine-tagged form of augmenter of liver regeneration reveals a novel cd(2)cl(4)o(6) cluster that aids in crystal packing
PDB Compounds: (C:) FAD-linked sulfhydryl oxidase ALR

SCOPe Domain Sequences for d3r7cc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r7cc_ a.24.15.1 (C:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkri
drsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc

SCOPe Domain Coordinates for d3r7cc_:

Click to download the PDB-style file with coordinates for d3r7cc_.
(The format of our PDB-style files is described here.)

Timeline for d3r7cc_: