SCOPe 2.08: Domain d3r7cb_: 3r7c B:

Lineage for d3r7cb_ (3r7c B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.24: Four-helical up-and-down bundle [47161] (29 superfamilies)
   core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down

4. Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families)

5. Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)

6. Protein automated matches [227081] (1 species)
   not a true protein

7. Species Norway rat (Rattus norvegicus) [TaxId:10116] [226341] (1 PDB entry)

8. Domain d3r7cb_: 3r7c B: [215613]
   automated match to d3tk0a_
   complexed with cd, cl, fad, so4

Details for d3r7cb_

PDB Entry: 3r7c, 2.4 Å

PDB Description: the structure of a hexahestidine-tagged form of augmenter of liver regeneration reveals a novel cd(2)cl(4)o(6) cluster that aids in crystal packing

PDB Compounds: (B:) FAD-linked sulfhydryl oxidase ALR

SCOPe Domain Sequences for d3r7cb_:

Sequence; same for both SEQRES and ATOM records:

>d3r7cb_ a.24.15.1 (B:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkri
drsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc

Timeline for d3r7cb_:

• d3r7cb_ first appeared in SCOPe 2.03
  
• d3r7cb_ appears in SCOPe 2.07