| Class a: All alpha proteins [46456] (284 folds) |
| Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies) core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down |
Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) ![]() |
| Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins) |
| Protein automated matches [227081] (1 species) not a true protein |
| Species Norway rat (Rattus norvegicus) [TaxId:10116] [226341] (1 PDB entry) |
| Domain d3r7ca_: 3r7c A: [215612] automated match to d3tk0a_ complexed with cd, cl, fad, so4 |
PDB Entry: 3r7c (more details), 2.4 Å
SCOPe Domain Sequences for d3r7ca_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r7ca_ a.24.15.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkri
drsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc
Timeline for d3r7ca_: