Lineage for d3r7ca_ (3r7c A:)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1263159Fold a.24: Four-helical up-and-down bundle [47161] (28 superfamilies)
    core: 4 helices; bundle, closed or partly opened, left-handed twist; up-and-down
  4. 1263825Superfamily a.24.15: FAD-dependent thiol oxidase [69000] (2 families) (S)
  5. 1263826Family a.24.15.1: FAD-dependent thiol oxidase [69001] (3 proteins)
  6. 1263848Protein automated matches [227081] (1 species)
    not a true protein
  7. 1263849Species Norway rat (Rattus norvegicus) [TaxId:10116] [226341] (1 PDB entry)
  8. 1263850Domain d3r7ca_: 3r7c A: [215612]
    automated match to d3tk0a_
    complexed with cd, cl, fad, so4

Details for d3r7ca_

PDB Entry: 3r7c (more details), 2.4 Å

PDB Description: the structure of a hexahestidine-tagged form of augmenter of liver regeneration reveals a novel cd(2)cl(4)o(6) cluster that aids in crystal packing
PDB Compounds: (A:) FAD-linked sulfhydryl oxidase ALR

SCOPe Domain Sequences for d3r7ca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r7ca_ a.24.15.1 (A:) automated matches {Norway rat (Rattus norvegicus) [TaxId: 10116]}
dcpqdreelgrntwaflhtlaayypdmptpeqqqdmaqfihifskfypceecaedirkri
drsqpdtstrvsfsqwlcrlhnevnrklgkpdfdcsrvderwrdgwkdgsc

SCOPe Domain Coordinates for d3r7ca_:

Click to download the PDB-style file with coordinates for d3r7ca_.
(The format of our PDB-style files is described here.)

Timeline for d3r7ca_: