Class b: All beta proteins [48724] (176 folds) |
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) |
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
Protein T-cell antigen receptor [49125] (7 species) |
Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (15 PDB entries) |
Domain d1beca2: 1bec A:118-246 [21561] Other proteins in same PDB: d1beca1 |
PDB Entry: 1bec (more details), 1.7 Å
SCOPe Domain Sequences for d1beca2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1beca2 b.1.1.2 (A:118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain [TaxId: 10090]} dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea wgrad
Timeline for d1beca2: