Lineage for d1bec_2 (1bec 118-246)
- Root: SCOP 1.61
Class b: All beta proteins [48724] (111 folds) 
Fold b.1: Immunoglobulin-like beta-sandwich [48725] (17 superfamilies) 
Superfamily b.1.1: Immunoglobulin [48726] (6 families) 
Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins) 
Protein T-cell antigen receptor [49125] (6 species) Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (10 PDB entries) 
Domain d1bec_2: 1bec 118-246 [21561]
Other proteins in same PDB: d1bec_1
Details for d1bec_2
PDB Entry: 1bec (more details), 1.7 Å
PDB Description: beta chain of a t cell antigen receptor
SCOP Domain Sequences for d1bec_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bec_2 b.1.1.2 (118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad
SCOP Domain Coordinates for d1bec_2:
Click to download the PDB-style file with coordinates for d1bec_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bec_2:
- d1bec_2 first appeared (with stable ids) in SCOP 1.55
- d1bec_2 appears in SCOP 1.59
- d1bec_2 appears in SCOP 1.63
- d1bec_2 appears in the current release, SCOPe 2.08, called d1beca2
View in 3D
