SCOP 1.59: Domain d1bec_2: 1bec 118-246

Lineage for d1bec_2 (1bec 118-246)

1. Root: SCOP 1.59

2. Class b: All beta proteins [48724] (110 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (15 superfamilies)

4. Superfamily b.1.1: Immunoglobulin [48726] (6 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (7 PDB entries)

8. Domain d1bec_2: 1bec 118-246 [21561]
   Other proteins in same PDB: d1bec_1

Details for d1bec_2

PDB Entry: 1bec, 1.7 Å

PDB Description: beta chain of a t cell antigen receptor

SCOP Domain Sequences for d1bec_2:

Sequence; same for both SEQRES and ATOM records:

>d1bec_2 b.1.1.2 (118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad

Timeline for d1bec_2:

• d1bec_2 first appeared (with stable ids) in SCOP 1.55
  
• d1bec_2 appears in SCOP 1.57
  
• d1bec_2 appears in SCOP 1.61
  
• d1bec_2 appears in the current release, SCOPe 2.08, called d1beca2