Lineage for d1bec_2 (1bec 118-246)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 9314Protein T-cell antigen receptor [49125] (4 species)
  7. 9336Species Mouse (Mus musculus), beta-chain [TaxId:10090] [49128] (7 PDB entries)
  8. 9337Domain d1bec_2: 1bec 118-246 [21561]
    Other proteins in same PDB: d1bec_1

Details for d1bec_2

PDB Entry: 1bec (more details), 1.7 Å

PDB Description: beta chain of a t cell antigen receptor

SCOP Domain Sequences for d1bec_2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bec_2 b.1.1.2 (118-246) T-cell antigen receptor {Mouse (Mus musculus), beta-chain}
dlrqvtppkvslfepskaeiankqkatlvclargffpdhvelswwvngkevhsgvstdpq
aykesnysyclssrlrvsatfwhnprnhfrcqvqfhglseedkwpegspkpvtqnisaea
wgrad

SCOP Domain Coordinates for d1bec_2:

Click to download the PDB-style file with coordinates for d1bec_2.
(The format of our PDB-style files is described here.)

Timeline for d1bec_2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1bec_1