Lineage for d1qsfd2 (1qsf D:118-206)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2356941Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2361044Protein T-cell antigen receptor [49125] (7 species)
  7. 2361045Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)
  8. 2361075Domain d1qsfd2: 1qsf D:118-206 [21560]
    Other proteins in same PDB: d1qsfa1, d1qsfa2, d1qsfb_, d1qsfd1, d1qsfe1

Details for d1qsfd2

PDB Entry: 1qsf (more details), 2.8 Å

PDB Description: structure of a6-tcr bound to hla-a2 complexed with altered htlv-1 tax peptide y8a
PDB Compounds: (D:) hman T-cell receptor

SCOPe Domain Sequences for d1qsfd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qsfd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d1qsfd2:

Click to download the PDB-style file with coordinates for d1qsfd2.
(The format of our PDB-style files is described here.)

Timeline for d1qsfd2: