SCOPe 2.08: Domain d3r6sb1: 3r6s B:3-147

Lineage for d3r6sb1 (3r6s B:3-147)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.82: Double-stranded beta-helix [51181] (7 superfamilies)
   one turn of helix is made by two pairs of antiparallel strands linked with short turns
   has appearance of a sandwich of distinct architecture and jelly-roll topology

4. Superfamily b.82.3: cAMP-binding domain-like [51206] (4 families)

5. Family b.82.3.0: automated matches [227198] (1 protein)
   not a true family

6. Protein automated matches [226927] (20 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [226339] (2 PDB entries)

8. Domain d3r6sb1: 3r6s B:3-147 [215599]
   Other proteins in same PDB: d3r6sa2, d3r6sb2, d3r6sc2, d3r6sd2, d3r6se2, d3r6sf2
   automated match to d1g6na2
   complexed with cmp, hez

Details for d3r6sb1

PDB Entry: 3r6s, 2.38 Å

PDB Description: Crystal structure of GlxR transcription factor from Corynebacterium glutamicum with cAMP

PDB Compounds: (B:) Transcription regulator

SCOPe Domain Sequences for d3r6sb1:

Sequence; same for both SEQRES and ATOM records:

>d3r6sb1 b.82.3.0 (B:3-147) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
gvqeilsragifqgvdptavnnliqdmetvrfprgatifdegepgdrlyiitsgkvklar
hapdgrenlltimgpsdmfgelsifdpgprtssavcvtevhaatmnsdmlrnwvadhpai
aeqllrvlarrlrrtnasladlift

Timeline for d3r6sb1:

• d3r6sb1 first appeared in SCOPe 2.03
  
• d3r6sb1 appears in SCOPe 2.07