SCOPe 2.04: Domain d3r6sa2: 3r6s A:148-227

Lineage for d3r6sa2 (3r6s A:148-227)

1. Root: SCOPe 2.04

2. Class a: All alpha proteins [46456] (285 folds)

3. Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
   core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down

4. Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families)
   contains a small beta-sheet (wing)

5. Family a.4.5.0: automated matches [191329] (1 protein)
   not a true family

6. Protein automated matches [190154] (52 species)
   not a true protein

7. Species Corynebacterium glutamicum [TaxId:1718] [226340] (2 PDB entries)

8. Domain d3r6sa2: 3r6s A:148-227 [215598]
   Other proteins in same PDB: d3r6sa1, d3r6sb1, d3r6sc1, d3r6sd1, d3r6se1, d3r6sf1
   automated match to d1i5za1
   complexed with cmp, hez

Details for d3r6sa2

PDB Entry: 3r6s, 2.38 Å

PDB Description: Crystal structure of GlxR transcription factor from Corynebacterium glutamicum with cAMP

PDB Compounds: (A:) Transcription regulator

SCOPe Domain Sequences for d3r6sa2:

Sequence; same for both SEQRES and ATOM records:

>d3r6sa2 a.4.5.0 (A:148-227) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dvpgrvaktllqlanrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwi
rlegksvlivdtehlarrar

Timeline for d3r6sa2:

• d3r6sa2 first appeared in SCOPe 2.03
  
• d3r6sa2 appears in SCOPe 2.05
  
• d3r6sa2 appears in the current release, SCOPe 2.08