Lineage for d3r6sa2 (3r6s A:148-227)

  1. Root: SCOPe 2.03
  2. 1253684Class a: All alpha proteins [46456] (284 folds)
  3. 1257871Fold a.4: DNA/RNA-binding 3-helical bundle [46688] (14 superfamilies)
    core: 3-helices; bundle, closed or partly opened, right-handed twist; up-and down
  4. 1258750Superfamily a.4.5: "Winged helix" DNA-binding domain [46785] (85 families) (S)
    contains a small beta-sheet (wing)
  5. 1260111Family a.4.5.0: automated matches [191329] (1 protein)
    not a true family
  6. 1260112Protein automated matches [190154] (41 species)
    not a true protein
  7. 1260153Species Corynebacterium glutamicum [TaxId:1718] [226340] (1 PDB entry)
  8. 1260154Domain d3r6sa2: 3r6s A:148-227 [215598]
    Other proteins in same PDB: d3r6sa1, d3r6sb1, d3r6sc1, d3r6sd1, d3r6se1, d3r6sf1
    automated match to d1i5za1
    complexed with cmp, hez

Details for d3r6sa2

PDB Entry: 3r6s (more details), 2.38 Å

PDB Description: Crystal structure of GlxR transcription factor from Corynebacterium glutamicum with cAMP
PDB Compounds: (A:) Transcription regulator

SCOPe Domain Sequences for d3r6sa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r6sa2 a.4.5.0 (A:148-227) automated matches {Corynebacterium glutamicum [TaxId: 1718]}
dvpgrvaktllqlanrfgtqeagalrvnhdltqeeiaqlvgasretvnkalatfahrgwi
rlegksvlivdtehlarrar

SCOPe Domain Coordinates for d3r6sa2:

Click to download the PDB-style file with coordinates for d3r6sa2.
(The format of our PDB-style files is described here.)

Timeline for d3r6sa2: