Lineage for d3r66b_ (3r66 B:)

  1. Root: SCOPe 2.07
  2. 2299346Class a: All alpha proteins [46456] (289 folds)
  3. 2311085Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
    3 helices; irregular array
  4. 2311086Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (4 families) (S)
  5. 2311087Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)
  6. 2311100Protein automated matches [190929] (8 species)
    not a true protein
  7. 2311136Species Influenza B virus [TaxId:107412] [193690] (3 PDB entries)
  8. 2311141Domain d3r66b_: 3r66 B: [215595]
    Other proteins in same PDB: d3r66c1, d3r66c2, d3r66d1, d3r66d2
    automated match to d3rt3c_

Details for d3r66b_

PDB Entry: 3r66 (more details), 2.3 Å

PDB Description: crystal structure of human isg15 in complex with ns1 n-terminal region from influenza virus b, northeast structural genomics consortium target ids hx6481, hr2873, and or2
PDB Compounds: (B:) Non-structural protein 1

SCOPe Domain Sequences for d3r66b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r66b_ a.16.1.1 (B:) automated matches {Influenza B virus [TaxId: 107412]}
ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse
penkrmsleerkaigvkmmkvllfmdpsagiegfep

SCOPe Domain Coordinates for d3r66b_:

Click to download the PDB-style file with coordinates for d3r66b_.
(The format of our PDB-style files is described here.)

Timeline for d3r66b_: