SCOPe 2.03: Domain d3r66a_: 3r66 A:

Lineage for d3r66a_ (3r66 A:)

1. Root: SCOPe 2.03

2. Class a: All alpha proteins [46456] (284 folds)

3. Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily)
   3 helices; irregular array

4. Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families)

5. Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins)

6. Protein automated matches [190929] (3 species)
   not a true protein

7. Species Influenza b virus [TaxId:107412] [193690] (3 PDB entries)

8. Domain d3r66a_: 3r66 A: [215594]
   Other proteins in same PDB: d3r66c1, d3r66c2, d3r66d1, d3r66d2
   automated match to d3rt3c_

Details for d3r66a_

PDB Entry: 3r66, 2.3 Å

PDB Description: crystal structure of human isg15 in complex with ns1 n-terminal region from influenza virus b, northeast structural genomics consortium target ids hx6481, hr2873, and or2

PDB Compounds: (A:) Non-structural protein 1

SCOPe Domain Sequences for d3r66a_:

Sequence; same for both SEQRES and ATOM records:

>d3r66a_ a.16.1.1 (A:) automated matches {Influenza b virus [TaxId: 107412]}
ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse
penkrmsleerkaigvkmmkvllfmdpsagiegfep

Timeline for d3r66a_:

• d3r66a_ is new in SCOPe 2.03-stable
  
• d3r66a_ appears in SCOPe 2.04
  
• d3r66a_ appears in the current release, SCOPe 2.08