Class a: All alpha proteins [46456] (284 folds) |
Fold a.16: S15/NS1 RNA-binding domain [47059] (1 superfamily) 3 helices; irregular array |
Superfamily a.16.1: S15/NS1 RNA-binding domain [47060] (3 families) |
Family a.16.1.1: N-terminal, RNA-binding domain of nonstructural protein NS1 [47061] (2 proteins) |
Protein automated matches [190929] (3 species) not a true protein |
Species Influenza b virus [TaxId:107412] [193690] (3 PDB entries) |
Domain d3r66a_: 3r66 A: [215594] Other proteins in same PDB: d3r66c1, d3r66c2, d3r66d1, d3r66d2 automated match to d3rt3c_ |
PDB Entry: 3r66 (more details), 2.3 Å
SCOPe Domain Sequences for d3r66a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r66a_ a.16.1.1 (A:) automated matches {Influenza b virus [TaxId: 107412]} ttqievgpgatnatinfeagilecyerfswqraldypgqdrlhrlkrklesrikthnkse penkrmsleerkaigvkmmkvllfmdpsagiegfep
Timeline for d3r66a_: