Lineage for d3r5xd1 (3r5x D:94-304)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2978525Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2978526Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2979068Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2979069Protein automated matches [226904] (39 species)
    not a true protein
  7. 2979085Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226104] (1 PDB entry)
  8. 2979089Domain d3r5xd1: 3r5x D:94-304 [215593]
    Other proteins in same PDB: d3r5xa2, d3r5xa3, d3r5xb2, d3r5xb3, d3r5xc2, d3r5xc3, d3r5xd2, d3r5xd3
    automated match to d1e4ea2
    complexed with acy, atp, ca, edo, mg

Details for d3r5xd1

PDB Entry: 3r5x (more details), 2 Å

PDB Description: crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp
PDB Compounds: (D:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3r5xd1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r5xd1 d.142.1.0 (D:94-304) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
dkniskkilryegietpdwieltkmedlnfdeldklgfplvvkpnsggssvgvkivydkd
elismletvfewdsevviekyikgeeitcsifdgkqlpiisirhaaeffdynakyddast
ieevielpaelkervnkaslacykalkcsvyarvdmmvkdgipyvmevntlpgmtqasll
pksadaagihysklldmiietslrvrkeegf

SCOPe Domain Coordinates for d3r5xd1:

Click to download the PDB-style file with coordinates for d3r5xd1.
(The format of our PDB-style files is described here.)

Timeline for d3r5xd1: