SCOPe 2.05: Domain d3r5xc1: 3r5x C:94-304

Lineage for d3r5xc1 (3r5x C:94-304)

1. Root: SCOPe 2.05

2. Class d: Alpha and beta proteins (a+b) [53931] (381 folds)

3. Fold d.142: ATP-grasp [56058] (2 superfamilies)
   Consists of two subdomains with different alpha+beta folds
   shares functional and structural similarities with the PIPK and protein kinase superfamilies

4. Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families)

5. Family d.142.1.0: automated matches [227184] (1 protein)
   not a true family

6. Protein automated matches [226904] (27 species)
   not a true protein

7. Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226104] (1 PDB entry)

8. Domain d3r5xc1: 3r5x C:94-304 [215592]
   Other proteins in same PDB: d3r5xa2, d3r5xb2, d3r5xc2, d3r5xd2
   automated match to d1e4ea2
   complexed with acy, atp, ca, edo, mg

Details for d3r5xc1

PDB Entry: 3r5x, 2 Å

PDB Description: crystal structure of d-alanine--d-alanine ligase from bacillus anthracis complexed with atp

PDB Compounds: (C:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3r5xc1:

Sequence, based on SEQRES records:

>d3r5xc1 d.142.1.0 (C:94-304) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
dkniskkilryegietpdwieltkmedlnfdeldklgfplvvkpnsggssvgvkivydkd
elismletvfewdsevviekyikgeeitcsifdgkqlpiisirhaaeffdynakyddast
ieevielpaelkervnkaslacykalkcsvyarvdmmvkdgipyvmevntlpgmtqasll
pksadaagihysklldmiietslrvrkeegf

Sequence, based on observed residues (ATOM records):

>d3r5xc1 d.142.1.0 (C:94-304) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]}
dkniskkilryegietpdwieltkmedlnfdeldklgfplvvkpngvkivydkdelisml
etvfewdsevviekyikgeeitcsifdgkqlpiisirhtieevielpaelkervnkasla
cykalkcsvyarvdmmvkdgipyvmevntlpgmtqasllpksadaagihysklldmiiet
slrvrkeegf

Timeline for d3r5xc1:

• d3r5xc1 first appeared in SCOPe 2.03
  
• d3r5xc1 appears in SCOPe 2.04
  
• d3r5xc1 appears in SCOPe 2.06
  
• d3r5xc1 appears in the current release, SCOPe 2.08