![]() | Class d: Alpha and beta proteins (a+b) [53931] (381 folds) |
![]() | Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
![]() | Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (10 families) ![]() |
![]() | Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
![]() | Protein automated matches [226904] (27 species) not a true protein |
![]() | Species Anthrax bacillus (Bacillus anthracis) [TaxId:1392] [226104] (1 PDB entry) |
![]() | Domain d3r5xb1: 3r5x B:94-303 [215591] Other proteins in same PDB: d3r5xa2, d3r5xb2, d3r5xc2, d3r5xd2 automated match to d1e4ea2 complexed with acy, atp, ca, edo, mg |
PDB Entry: 3r5x (more details), 2 Å
SCOPe Domain Sequences for d3r5xb1:
Sequence, based on SEQRES records: (download)
>d3r5xb1 d.142.1.0 (B:94-303) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} dkniskkilryegietpdwieltkmedlnfdeldklgfplvvkpnsggssvgvkivydkd elismletvfewdsevviekyikgeeitcsifdgkqlpiisirhaaeffdynakyddast ieevielpaelkervnkaslacykalkcsvyarvdmmvkdgipyvmevntlpgmtqasll pksadaagihysklldmiietslrvrkeeg
>d3r5xb1 d.142.1.0 (B:94-303) automated matches {Anthrax bacillus (Bacillus anthracis) [TaxId: 1392]} dkniskkilryegietpdwieltkmedlnfdeldklgfplvvkpnsggvkivydkdelis mletvfewdsevviekyikgeeitcsifdgkqlpiisirhaaeffstieevielpaelke rvnkaslacykalkcsvyarvdmmvkdgipyvmevntlpgmtqasllpksadaagihysk lldmiietslrvrkeeg
Timeline for d3r5xb1: