SCOPe 2.07: Domain d3r5fa1: 3r5f A:3-139

Lineage for d3r5fa1 (3r5f A:3-139)

1. Root: SCOPe 2.07

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.30: PreATP-grasp domain [52439] (1 superfamily)
   3 layers: a/b/a; parallel or mixed beta-sheet of 4 to 6 strands
   possible rudiment form of Rossmann-fold domain

4. Superfamily c.30.1: PreATP-grasp domain [52440] (10 families)
   precedes the ATP-grasp domain common to all superfamily members, can contain a substrate-binding function

5. Family c.30.1.0: automated matches [227183] (1 protein)
   not a true family

6. Protein automated matches [226903] (39 species)
   not a true protein

7. Species Xanthomonas oryzae [TaxId:291331] [226135] (1 PDB entry)

8. Domain d3r5fa1: 3r5f A:3-139 [215588]
   Other proteins in same PDB: d3r5fa2
   automated match to d1ehia1
   complexed with atp, mg

Details for d3r5fa1

PDB Entry: 3r5f, 2.07 Å

PDB Description: Crystal structure of D-alanine-D-alnine ligase from Xanthomonas oryzae pv. oryzae with ATP

PDB Compounds: (A:) D-alanine--D-alanine ligase 1

SCOPe Domain Sequences for d3r5fa1:

Sequence, based on SEQRES records:

>d3r5fa1 c.30.1.0 (A:3-139) automated matches {Xanthomonas oryzae [TaxId: 291331]}
kirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllhad
dparialhrsgrgvallpgaqqqqlrpiqpeqalaqidvvfpivhgtlgedgslqgllrm
anlpfvgsgvlgsavam

Sequence, based on observed residues (ATOM records):

>d3r5fa1 c.30.1.0 (A:3-139) automated matches {Xanthomonas oryzae [TaxId: 291331]}
kirvglifggksaehevslqsarnildaldpqrfepvligidkqgqwhvndpdsfllhad
dparialhrsgrgvallpgaqqqqlrpiqalaqidvvfpivhgtlgedgslqgllrmanl
pfvgsgvlgsavam

Timeline for d3r5fa1:

• d3r5fa1 first appeared in SCOPe 2.03
  
• d3r5fa1 appears in SCOPe 2.06
  
• d3r5fa1 appears in the current release, SCOPe 2.08