Lineage for d3r58a_ (3r58 A:)

  1. Root: SCOPe 2.06
  2. 2078559Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2078560Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2080913Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) (S)
  5. 2080914Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 protein domains)
    Common fold covers whole protein structure
  6. 2081137Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species)
    Aldo-keto reductase family 1 member c3
  7. 2081138Species Human (Homo sapiens) [TaxId:9606] [102052] (43 PDB entries)
    Uniprot P42330
  8. 2081181Domain d3r58a_: 3r58 A: [215586]
    automated match to d4h7ca_
    complexed with edo, nap, nps

Details for d3r58a_

PDB Entry: 3r58 (more details), 2.3 Å

PDB Description: AKR1C3 complex with naproxen
PDB Compounds: (A:) Aldo-keto reductase family 1 member C3

SCOPe Domain Sequences for d3r58a_:

Sequence, based on SEQRES records: (download)

>d3r58a_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg
eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk
pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala
kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy
fnsdsfashpnypysde

Sequence, based on observed residues (ATOM records): (download)

>d3r58a_ c.1.7.1 (A:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]}
qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai
rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpi
fdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkykpvcnqvechpyfn
rsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcalakkhkrtpalialr
yqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhyfnsdsfashpnyp
ysde

SCOPe Domain Coordinates for d3r58a_:

Click to download the PDB-style file with coordinates for d3r58a_.
(The format of our PDB-style files is described here.)

Timeline for d3r58a_: