![]() | Class b: All beta proteins [48724] (174 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein T-cell antigen receptor [49125] (6 species) |
![]() | Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (16 PDB entries) |
![]() | Domain d1qrnd2: 1qrn D:118-206 [21558] Other proteins in same PDB: d1qrna1, d1qrna2, d1qrnb_, d1qrnd1, d1qrne1 |
PDB Entry: 1qrn (more details), 2.8 Å
SCOPe Domain Sequences for d1qrnd2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qrnd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdkdvyitdktvldmrsmdfksns avawsnksdfacanafnnsiipedtffps
Timeline for d1qrnd2: