Lineage for d1qrnd2 (1qrn D:118-206)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 9314Protein T-cell antigen receptor [49125] (4 species)
  7. 9315Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (5 PDB entries)
  8. 9318Domain d1qrnd2: 1qrn D:118-206 [21558]
    Other proteins in same PDB: d1qrna1, d1qrna2, d1qrnb1, d1qrnd1, d1qrne1

Details for d1qrnd2

PDB Entry: 1qrn (more details), 2.8 Å

PDB Description: crystal structure of human a6 tcr complexed with hla-a2 bound to altered htlv-1 tax peptide p6a

SCOP Domain Sequences for d1qrnd2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qrnd2 b.1.1.2 (D:118-206) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdkdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

SCOP Domain Coordinates for d1qrnd2:

Click to download the PDB-style file with coordinates for d1qrnd2.
(The format of our PDB-style files is described here.)

Timeline for d1qrnd2: