Lineage for d3r50e_ (3r50 E:)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2079052Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2079092Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2079227Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2079228Protein automated matches [190516] (4 species)
    not a true protein
  7. 2079262Species Sweet potato (Ipomoea batatas) [TaxId:4120] [193613] (4 PDB entries)
  8. 2079277Domain d3r50e_: 3r50 E: [215576]
    automated match to d4ddnb_

Details for d3r50e_

PDB Entry: 3r50 (more details), 2.27 Å

PDB Description: Structure analysis of a wound-inducible lectin ipomoelin from sweet potato
PDB Compounds: (E:) Ipomoelin

SCOPe Domain Sequences for d3r50e_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r50e_ b.77.3.0 (E:) automated matches {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
qlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitfssnptdiit
vggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygpyganagtpf
nikipdgnkivgffgnsgwyvdaigayytak

SCOPe Domain Coordinates for d3r50e_:

Click to download the PDB-style file with coordinates for d3r50e_.
(The format of our PDB-style files is described here.)

Timeline for d3r50e_: