Lineage for d3r50c_ (3r50 C:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2813105Fold b.77: beta-Prism I [51091] (4 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 2813155Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 2813299Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 2813300Protein automated matches [190516] (5 species)
    not a true protein
  7. 2813343Species Sweet potato (Ipomoea batatas) [TaxId:4120] [193613] (4 PDB entries)
  8. 2813354Domain d3r50c_: 3r50 C: [215574]
    automated match to d4ddnb_

Details for d3r50c_

PDB Entry: 3r50 (more details), 2.27 Å

PDB Description: Structure analysis of a wound-inducible lectin ipomoelin from sweet potato
PDB Compounds: (C:) Ipomoelin

SCOPe Domain Sequences for d3r50c_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r50c_ b.77.3.0 (C:) automated matches {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
alqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitfssnptdi
itvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygpyganagt
pfnikipdgnkivgffgnsgwyvdaigayytak

SCOPe Domain Coordinates for d3r50c_:

Click to download the PDB-style file with coordinates for d3r50c_.
(The format of our PDB-style files is described here.)

Timeline for d3r50c_: