Lineage for d3r50a_ (3r50 A:)

  1. Root: SCOPe 2.04
  2. 1510239Class b: All beta proteins [48724] (176 folds)
  3. 1557282Fold b.77: beta-Prism I [51091] (3 superfamilies)
    consists of 3 4-stranded sheets; strands are parallel to the 3-fold axis
    duplication: has internal pseudo threefold symmetry
  4. 1557319Superfamily b.77.3: Mannose-binding lectins [51101] (2 families) (S)
  5. 1557435Family b.77.3.0: automated matches [191397] (1 protein)
    not a true family
  6. 1557436Protein automated matches [190516] (2 species)
    not a true protein
  7. 1557450Species Sweet potato (Ipomoea batatas) [TaxId:4120] [193613] (4 PDB entries)
  8. 1557461Domain d3r50a_: 3r50 A: [215572]
    automated match to d4ddnb_

Details for d3r50a_

PDB Entry: 3r50 (more details), 2.27 Å

PDB Description: Structure analysis of a wound-inducible lectin ipomoelin from sweet potato
PDB Compounds: (A:) Ipomoelin

SCOPe Domain Sequences for d3r50a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r50a_ b.77.3.0 (A:) automated matches {Sweet potato (Ipomoea batatas) [TaxId: 4120]}
alqlaahsdarsgpvgsnggqfwsfrpvrplnkivlsfsgspdqtlnlisitfssnptdi
itvggvgpepltytetvnidgdiieisgmianykgynvirsikfttnkkeygpyganagt
pfnikipdgnkivgffgnsgwyvdaigayytak

SCOPe Domain Coordinates for d3r50a_:

Click to download the PDB-style file with coordinates for d3r50a_.
(The format of our PDB-style files is described here.)

Timeline for d3r50a_: