Lineage for d1bd2d2 (1bd2 D:118-203)

  1. Root: SCOP 1.67
  2. 362614Class b: All beta proteins [48724] (141 folds)
  3. 362615Fold b.1: Immunoglobulin-like beta-sandwich [48725] (22 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 362616Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 364354Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (22 proteins)
  6. 366220Protein T-cell antigen receptor [49125] (6 species)
  7. 366221Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (9 PDB entries)
  8. 366227Domain d1bd2d2: 1bd2 D:118-203 [21557]
    Other proteins in same PDB: d1bd2a1, d1bd2a2, d1bd2b_, d1bd2d1, d1bd2e1

Details for d1bd2d2

PDB Entry: 1bd2 (more details), 2.5 Å

PDB Description: complex between human t-cell receptor b7, viral peptide (tax) and mhc class i molecule hla-a 0201

SCOP Domain Sequences for d1bd2d2:

Sequence, based on SEQRES records: (download)

>d1bd2d2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records): (download)

>d1bd2d2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdktvldmdfksnsavawsnk
sdfacanafnnsiipedtf

SCOP Domain Coordinates for d1bd2d2:

Click to download the PDB-style file with coordinates for d1bd2d2.
(The format of our PDB-style files is described here.)

Timeline for d1bd2d2: