Lineage for d1bd2d2 (1bd2 D:118-203)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749668Protein T-cell antigen receptor [49125] (7 species)
  7. 2749669Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (26 PDB entries)
  8. 2749700Domain d1bd2d2: 1bd2 D:118-203 [21557]
    Other proteins in same PDB: d1bd2a1, d1bd2a2, d1bd2b_, d1bd2d1, d1bd2e1
    missing some secondary structures that made up less than one-third of the common domain

Details for d1bd2d2

PDB Entry: 1bd2 (more details), 2.5 Å

PDB Description: complex between human t-cell receptor b7, viral peptide (tax) and mhc class i molecule hla-a 0201
PDB Compounds: (D:) t cell receptor alpha

SCOPe Domain Sequences for d1bd2d2:

Sequence, based on SEQRES records: (download)

>d1bd2d2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records): (download)

>d1bd2d2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain [TaxId: 9606]}
iqnpdpavyqlrdsksvclftdfdsqtnvsqskdsdvyitdktvldmrfksnsavawsnk
sdfacanafnnsiipedtf

SCOPe Domain Coordinates for d1bd2d2:

Click to download the PDB-style file with coordinates for d1bd2d2.
(The format of our PDB-style files is described here.)

Timeline for d1bd2d2: