Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.38: Thioesterase/thiol ester dehydrase-isomerase [54636] (1 superfamily) core: beta-alpha-beta(4); 2 layers: alpha/beta |
Superfamily d.38.1: Thioesterase/thiol ester dehydrase-isomerase [54637] (10 families) |
Family d.38.1.5: PaaI/YdiI-like [89902] (15 proteins) |
Protein automated matches [190102] (7 species) not a true protein |
Species Arthrobacter sp. [TaxId:1667] [194804] (11 PDB entries) |
Domain d3r3ab_: 3r3a B: [215564] automated match to d3r3bb_ complexed with coa, phb; mutant |
PDB Entry: 3r3a (more details), 1.8 Å
SCOPe Domain Sequences for d3r3ab_:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r3ab_ d.38.1.5 (B:) automated matches {Arthrobacter sp. [TaxId: 1667]} ggnlpdvashypvayeqtldgtvgfvidemtperatasvevtdtlrarwglvhggaycal aemlateatvavvhekgmmavgqsnhtsffrpvkeghvraeavrihagsttwfwdvslrd dagrlcavssmsiavrprrd
Timeline for d3r3ab_: