Lineage for d1fytd2 (1fyt D:118-203)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 9314Protein T-cell antigen receptor [49125] (4 species)
  7. 9315Species Human (Homo sapiens), alpha-chain [TaxId:9606] [49127] (5 PDB entries)
  8. 9316Domain d1fytd2: 1fyt D:118-203 [21556]
    Other proteins in same PDB: d1fyta1, d1fyta2, d1fytb1, d1fytb2, d1fytd1, d1fyte1

Details for d1fytd2

PDB Entry: 1fyt (more details), 2.6 Å

PDB Description: crystal structure of a complex of a human alpha/beta-t cell receptor, influenza ha antigen peptide, and mhc class ii molecule, hla-dr1

SCOP Domain Sequences for d1fytd2:

Sequence, based on SEQRES records: (download)

>d1fytd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksns
avawsnksdfacanafnnsiipedtf

Sequence, based on observed residues (ATOM records): (download)

>d1fytd2 b.1.1.2 (D:118-203) T-cell antigen receptor {Human (Homo sapiens), alpha-chain}
iqnpdpavyqlrssdksvclftdfdsqtnvsqskdsdvyitdktvldmrsmdfksnsava
wsnksdfacanafnnsiipedtf

SCOP Domain Coordinates for d1fytd2:

Click to download the PDB-style file with coordinates for d1fytd2.
(The format of our PDB-style files is described here.)

Timeline for d1fytd2: