Lineage for d3r2ta2 (3r2t A:129-232)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1892544Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 1894514Superfamily d.15.6: Superantigen toxins, C-terminal domain [54334] (2 families) (S)
  5. 1894732Family d.15.6.0: automated matches [227139] (1 protein)
    not a true family
  6. 1894733Protein automated matches [226841] (5 species)
    not a true protein
  7. 1894756Species Staphylococcus aureus [TaxId:93061] [226096] (6 PDB entries)
  8. 1894763Domain d3r2ta2: 3r2t A:129-232 [215558]
    Other proteins in same PDB: d3r2ta1, d3r2tb1
    automated match to d2z8la2
    complexed with so4

Details for d3r2ta2

PDB Entry: 3r2t (more details), 2.21 Å

PDB Description: 2.2 angstrom resolution crystal structure of superantigen-like protein from staphylococcus aureus subsp. aureus nctc 8325.
PDB Compounds: (A:) Putative uncharacterized protein

SCOPe Domain Sequences for d3r2ta2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r2ta2 d.15.6.0 (A:129-232) automated matches {Staphylococcus aureus [TaxId: 93061]}
sifeslrtpnllvkkiddkdgfsidefffiqkeevslkeldfkirkllikkyklyegsad
kgrivinmkdenkyeidlsdkldfermadvinseqiknievnlk

SCOPe Domain Coordinates for d3r2ta2:

Click to download the PDB-style file with coordinates for d3r2ta2.
(The format of our PDB-style files is described here.)

Timeline for d3r2ta2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r2ta1