Class b: All beta proteins [48724] (176 folds) |
Fold b.40: OB-fold [50198] (16 superfamilies) barrel, closed or partly opened n=5, S=10 or S=8; greek-key |
Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) |
Family b.40.2.0: automated matches [227133] (1 protein) not a true family |
Protein automated matches [226834] (5 species) not a true protein |
Species Staphylococcus aureus [TaxId:93062] [225286] (3 PDB entries) |
Domain d3r2ia1: 3r2i A:39-126 [215555] Other proteins in same PDB: d3r2ia2 automated match to d1v1oa1 |
PDB Entry: 3r2i (more details), 2.3 Å
SCOPe Domain Sequences for d3r2ia1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r2ia1 b.40.2.0 (A:39-126) automated matches {Staphylococcus aureus [TaxId: 93062]} rkyyinmlhqyyseesfeptnisvksedyygsnvlnfkqrnkafkvfllgddknkykekt hgldvfavpelidikggiysvggitkkn
Timeline for d3r2ia1: