Lineage for d3r2ia1 (3r2i A:39-126)

  1. Root: SCOPe 2.03
  2. 1287432Class b: All beta proteins [48724] (174 folds)
  3. 1313473Fold b.40: OB-fold [50198] (16 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 1313712Superfamily b.40.2: Bacterial enterotoxins [50203] (3 families) (S)
  5. 1314466Family b.40.2.0: automated matches [227133] (1 protein)
    not a true family
  6. 1314467Protein automated matches [226834] (4 species)
    not a true protein
  7. 1314491Species Staphylococcus aureus [TaxId:93062] [225286] (3 PDB entries)
  8. 1314494Domain d3r2ia1: 3r2i A:39-126 [215555]
    Other proteins in same PDB: d3r2ia2
    automated match to d1v1oa1

Details for d3r2ia1

PDB Entry: 3r2i (more details), 2.3 Å

PDB Description: crystal structure of superantigen-like protein, exotoxin sacol0473 from staphylococcus aureus subsp. aureus col
PDB Compounds: (A:) Exotoxin 5

SCOPe Domain Sequences for d3r2ia1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r2ia1 b.40.2.0 (A:39-126) automated matches {Staphylococcus aureus [TaxId: 93062]}
rkyyinmlhqyyseesfeptnisvksedyygsnvlnfkqrnkafkvfllgddknkykekt
hgldvfavpelidikggiysvggitkkn

SCOPe Domain Coordinates for d3r2ia1:

Click to download the PDB-style file with coordinates for d3r2ia1.
(The format of our PDB-style files is described here.)

Timeline for d3r2ia1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r2ia2