Lineage for d3r23a1 (3r23 A:94-303)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2585054Fold d.142: ATP-grasp [56058] (2 superfamilies)
    Consists of two subdomains with different alpha+beta folds
    shares functional and structural similarities with the PIPK and protein kinase superfamilies
  4. 2585055Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) (S)
  5. 2585592Family d.142.1.0: automated matches [227184] (1 protein)
    not a true family
  6. 2585593Protein automated matches [226904] (38 species)
    not a true protein
  7. 2585617Species Bacillus anthracis [TaxId:198094] [226099] (1 PDB entry)
  8. 2585618Domain d3r23a1: 3r23 A:94-303 [215540]
    Other proteins in same PDB: d3r23a2, d3r23a3, d3r23b2, d3r23b3
    automated match to d1e4ea2
    complexed with edo

Details for d3r23a1

PDB Entry: 3r23 (more details), 2.5 Å

PDB Description: Crystal Structure of D-alanine--D-Alanine Ligase from Bacillus anthracis
PDB Compounds: (A:) d-alanine--d-alanine ligase

SCOPe Domain Sequences for d3r23a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r23a1 d.142.1.0 (A:94-303) automated matches {Bacillus anthracis [TaxId: 198094]}
dkniskkilryegietpdwieltkmedlnfdeldklgfplvvkpnsggssvgvkivydkd
elismletvfewdsevviekyikgeeitcsifdgkqlpiisirhaaeffdynakyddast
ieevielpaelkervnkaslacykalkcsvyarvdmmvkdgipyvmevntlpgmtqasll
pksadaagihysklldmiietslrvrkeeg

SCOPe Domain Coordinates for d3r23a1:

Click to download the PDB-style file with coordinates for d3r23a1.
(The format of our PDB-style files is described here.)

Timeline for d3r23a1: