Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.142: ATP-grasp [56058] (2 superfamilies) Consists of two subdomains with different alpha+beta folds shares functional and structural similarities with the PIPK and protein kinase superfamilies |
Superfamily d.142.1: Glutathione synthetase ATP-binding domain-like [56059] (11 families) |
Family d.142.1.0: automated matches [227184] (1 protein) not a true family |
Protein automated matches [226904] (38 species) not a true protein |
Species Bacillus anthracis [TaxId:198094] [226099] (1 PDB entry) |
Domain d3r23a1: 3r23 A:94-303 [215540] Other proteins in same PDB: d3r23a2, d3r23a3, d3r23b2, d3r23b3 automated match to d1e4ea2 complexed with edo |
PDB Entry: 3r23 (more details), 2.5 Å
SCOPe Domain Sequences for d3r23a1:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r23a1 d.142.1.0 (A:94-303) automated matches {Bacillus anthracis [TaxId: 198094]} dkniskkilryegietpdwieltkmedlnfdeldklgfplvvkpnsggssvgvkivydkd elismletvfewdsevviekyikgeeitcsifdgkqlpiisirhaaeffdynakyddast ieevielpaelkervnkaslacykalkcsvyarvdmmvkdgipyvmevntlpgmtqasll pksadaagihysklldmiietslrvrkeeg
Timeline for d3r23a1: