Lineage for d1g6ra2 (1g6r A:118-213)

  1. Root: SCOP 1.63
  2. 218896Class b: All beta proteins [48724] (119 folds)
  3. 218897Fold b.1: Immunoglobulin-like beta-sandwich [48725] (20 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 218898Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 220405Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 221982Protein T-cell antigen receptor [49125] (6 species)
  7. 222014Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (5 PDB entries)
  8. 222022Domain d1g6ra2: 1g6r A:118-213 [21554]
    Other proteins in same PDB: d1g6ra1, d1g6rb1, d1g6rc1, d1g6rd1, d1g6rh1, d1g6rh2, d1g6ri1, d1g6ri2, d1g6rl_, d1g6rm_

Details for d1g6ra2

PDB Entry: 1g6r (more details), 2.8 Å

PDB Description: a functional hot spot for antigen recognition in a superagonist tcr/mhc complex

SCOP Domain Sequences for d1g6ra2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1g6ra2 b.1.1.2 (A:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

SCOP Domain Coordinates for d1g6ra2:

Click to download the PDB-style file with coordinates for d1g6ra2.
(The format of our PDB-style files is described here.)

Timeline for d1g6ra2: