Lineage for d2ckbc2 (2ckb C:118-213)

  1. Root: SCOP 1.75
  2. 781541Class b: All beta proteins [48724] (174 folds)
  3. 781542Fold b.1: Immunoglobulin-like beta-sandwich [48725] (28 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 781543Superfamily b.1.1: Immunoglobulin [48726] (4 families) (S)
  5. 783929Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)
  6. 786831Protein T-cell antigen receptor [49125] (6 species)
  7. 786912Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (11 PDB entries)
  8. 786928Domain d2ckbc2: 2ckb C:118-213 [21553]
    Other proteins in same PDB: d2ckba1, d2ckbb1, d2ckbc1, d2ckbd1, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl_, d2ckbm_

Details for d2ckbc2

PDB Entry: 2ckb (more details), 3 Å

PDB Description: structure of the 2c/kb/dev8 complex
PDB Compounds: (C:) alpha, beta t cell receptor

SCOP Domain Sequences for d2ckbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbc2 b.1.1.2 (C:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

SCOP Domain Coordinates for d2ckbc2:

Click to download the PDB-style file with coordinates for d2ckbc2.
(The format of our PDB-style files is described here.)

Timeline for d2ckbc2: