Lineage for d2ckbc2 (2ckb C:118-213)

  1. Root: SCOP 1.55
  2. 6992Class b: All beta proteins [48724] (93 folds)
  3. 6993Fold b.1: Immunoglobulin-like beta-sandwich [48725] (14 superfamilies)
  4. 6994Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 8163Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (9 proteins)
  6. 9314Protein T-cell antigen receptor [49125] (4 species)
  7. 9328Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (4 PDB entries)
  8. 9333Domain d2ckbc2: 2ckb C:118-213 [21553]
    Other proteins in same PDB: d2ckba1, d2ckbb1, d2ckbc1, d2ckbd1, d2ckbh1, d2ckbh2, d2ckbi1, d2ckbi2, d2ckbl1, d2ckbm1

Details for d2ckbc2

PDB Entry: 2ckb (more details), 3.2 Å

PDB Description: structure of the 2c/kb/dev8 complex

SCOP Domain Sequences for d2ckbc2:

Sequence; same for both SEQRES and ATOM records: (download)

>d2ckbc2 b.1.1.2 (C:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain}
iqnpepavyalkdprsqdstlclftdfdsqinvpktmesgtfitdatvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

SCOP Domain Coordinates for d2ckbc2:

Click to download the PDB-style file with coordinates for d2ckbc2.
(The format of our PDB-style files is described here.)

Timeline for d2ckbc2: