SCOPe 2.05: Domain d3r1ia_: 3r1i A:

Lineage for d3r1ia_ (3r1i A:)

1. Root: SCOPe 2.05

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (203 species)
   not a true protein

7. Species Mycobacterium marinum [TaxId:216594] [189743] (2 PDB entries)

8. Domain d3r1ia_: 3r1i A: [215529]
   automated match to d3pk0a_
   complexed with edo, mg

Details for d3r1ia_

PDB Entry: 3r1i, 1.95 Å

PDB Description: crystal structure of a short-chain type dehydrogenase/reductase from mycobacterium marinum

PDB Compounds: (A:) Short-chain type dehydrogenase/reductase

SCOPe Domain Sequences for d3r1ia_:

Sequence; same for both SEQRES and ATOM records:

>d3r1ia_ c.2.1.0 (A:) automated matches {Mycobacterium marinum [TaxId: 216594]}
svldlfdlsgkralitgastgigkkvalayaeagaqvavaarhsdalqvvadeiagvggk
alpircdvtqpdqvrgmldqmtgelggidiavcnagivsvqamldmpleefqriqdtnvt
gvfltaqaaaramvdqglggtiittasmsghiinipqqvshyctskaavvhltkamavel
aphqirvnsvspgyirtelvepladyhalwepkiplgrmgrpeeltglylylasaassym
tgsdividggytcp

Timeline for d3r1ia_:

• d3r1ia_ first appeared in SCOPe 2.03
  
• d3r1ia_ appears in SCOPe 2.04
  
• d3r1ia_ appears in SCOPe 2.06
  
• d3r1ia_ appears in the current release, SCOPe 2.08