Lineage for d3r18a2 (3r18 A:344-466)

  1. Root: SCOPe 2.05
  2. 1755445Class b: All beta proteins [48724] (176 folds)
  3. 1755446Fold b.1: Immunoglobulin-like beta-sandwich [48725] (31 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 1770169Superfamily b.1.18: E set domains [81296] (24 families) (S)
    "Early" Ig-like fold families possibly related to the immunoglobulin and/or fibronectin type III superfamilies
  5. 1771068Family b.1.18.0: automated matches [191341] (1 protein)
    not a true family
  6. 1771069Protein automated matches [190226] (43 species)
    not a true protein
  7. 1771092Species Chicken (Gallus gallus) [TaxId:9031] [225870] (6 PDB entries)
  8. 1771095Domain d3r18a2: 3r18 A:344-466 [215526]
    Other proteins in same PDB: d3r18a1
    automated match to d1ogpa1
    complexed with mo, mte; mutant

Details for d3r18a2

PDB Entry: 3r18 (more details), 2.4 Å

PDB Description: chicken sulfite oxidase double mutant with altered activity and substrate affinity
PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d3r18a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r18a2 b.1.18.0 (A:344-466) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
elpvqsavtqprpgaavppgeltvkgyawsgggrevvrvdvsldggrtwkvarlmgdkap
pgrawawalweltvpveagteleivckavdssynvqpdsvapiwnlmgvlstawhrvrvs
vqd

SCOPe Domain Coordinates for d3r18a2:

Click to download the PDB-style file with coordinates for d3r18a2.
(The format of our PDB-style files is described here.)

Timeline for d3r18a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r18a1