Lineage for d3r18a1 (3r18 A:94-343)

  1. Root: SCOPe 2.05
  2. 1886641Class d: Alpha and beta proteins (a+b) [53931] (381 folds)
  3. 1942842Fold d.176: Oxidoreductase molybdopterin-binding domain [56523] (1 superfamily)
    unusual fold; contains 3 layers of beta-sheet structure and a beta-grasp like motif
  4. 1942843Superfamily d.176.1: Oxidoreductase molybdopterin-binding domain [56524] (2 families) (S)
  5. 1942881Family d.176.1.0: automated matches [227253] (1 protein)
    not a true family
  6. 1942882Protein automated matches [227034] (1 species)
    not a true protein
  7. 1942883Species Chicken (Gallus gallus) [TaxId:9031] [225869] (6 PDB entries)
  8. 1942886Domain d3r18a1: 3r18 A:94-343 [215525]
    Other proteins in same PDB: d3r18a2
    automated match to d1ogpa2
    complexed with mo, mte; mutant

Details for d3r18a1

PDB Entry: 3r18 (more details), 2.4 Å

PDB Description: chicken sulfite oxidase double mutant with altered activity and substrate affinity
PDB Compounds: (A:) sulfite oxidase

SCOPe Domain Sequences for d3r18a1:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r18a1 d.176.1.0 (A:94-343) automated matches {Chicken (Gallus gallus) [TaxId: 9031]}
qdpfagdpprhpglrvnsqkpfnaeppaellaerfltpnelfftrnhlpvpavepssyrl
rvdgpgggtlslslaelrsrfpkhevtatlqcagnrrsemsrvrpvkglpwdigaistar
wggarlrdvllhagfpeelqgewhvcfegldadpggapygasipygralspaadvllaye
mngtelprdhgfpvrvvvpgvvgarsvkwlrrvavspdespshwqqndnkgfspcvdwdt
vdyrtapaiq

SCOPe Domain Coordinates for d3r18a1:

Click to download the PDB-style file with coordinates for d3r18a1.
(The format of our PDB-style files is described here.)

Timeline for d3r18a1:

View in 3D
Domains from same chain:
(mouse over for more information)
d3r18a2