Lineage for d3r11a2 (3r11 A:128-357)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2826025Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2836768Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) (S)
    binds metal ion (magnesium or manganese) in conserved site inside barrel
    N-terminal alpha+beta domain is common to this superfamily
  5. 2837252Family c.1.11.0: automated matches [227196] (1 protein)
    not a true family
  6. 2837253Protein automated matches [226923] (79 species)
    not a true protein
  7. 2837522Species Francisella philomiragia [TaxId:484022] [226098] (5 PDB entries)
  8. 2837527Domain d3r11a2: 3r11 A:128-357 [215522]
    Other proteins in same PDB: d3r11a1, d3r11a3, d3r11a4, d3r11b1, d3r11b3, d3r11b4
    automated match to d1wufa1
    complexed with fum, gol, mg, so4

Details for d3r11a2

PDB Entry: 3r11 (more details), 2 Å

PDB Description: Crystal structure of NYSGRC enolase target 200555, a putative dipeptide epimerase from Francisella philomiragia : Mg and Fumarate complex
PDB Compounds: (A:) Enzyme of enolase superfamily

SCOPe Domain Sequences for d3r11a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r11a2 c.1.11.0 (A:128-357) automated matches {Francisella philomiragia [TaxId: 484022]}
kansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkaldnefskni
kfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsnipvvades
vfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmmespagila
tasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnl

SCOPe Domain Coordinates for d3r11a2:

Click to download the PDB-style file with coordinates for d3r11a2.
(The format of our PDB-style files is described here.)

Timeline for d3r11a2: