| Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
| Fold c.1: TIM beta/alpha-barrel [51350] (34 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.11: Enolase C-terminal domain-like [51604] (3 families) ![]() binds metal ion (magnesium or manganese) in conserved site inside barrel N-terminal alpha+beta domain is common to this superfamily |
| Family c.1.11.0: automated matches [227196] (1 protein) not a true family |
| Protein automated matches [226923] (79 species) not a true protein |
| Species Francisella philomiragia [TaxId:484022] [226098] (5 PDB entries) |
| Domain d3r10a2: 3r10 A:128-357 [215518] Other proteins in same PDB: d3r10a1, d3r10a3, d3r10a4, d3r10b1, d3r10b3, d3r10b4 automated match to d1wufa1 complexed with gol, mg, so4 |
PDB Entry: 3r10 (more details), 2 Å
SCOPe Domain Sequences for d3r10a2:
Sequence; same for both SEQRES and ATOM records: (download)
>d3r10a2 c.1.11.0 (A:128-357) automated matches {Francisella philomiragia [TaxId: 484022]}
kansivtdvsiscgnvaetiqniqngveanftaikvktgadfnrdiqllkaldnefskni
kfrfdanqgwnlaqtkqfieeinkyslnveiieqpvkyydikamaeitkfsnipvvades
vfdakdaervideqacnminiklaktggileaqkikkladsagiscmvgcmmespagila
tasfalaeditvadldpldwvakdlysdyitfnepniilkdnlkgfgfnl
Timeline for d3r10a2:
View in 3DDomains from other chains: (mouse over for more information) d3r10b1, d3r10b2, d3r10b3, d3r10b4 |