Lineage for d3r0ma_ (3r0m A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2355831Species Llama (Lama glama) [TaxId:9844] [187485] (223 PDB entries)
  8. 2355849Domain d3r0ma_: 3r0m A: [215511]
    automated match to d3rjqb_
    complexed with so4

Details for d3r0ma_

PDB Entry: 3r0m (more details), 1.5 Å

PDB Description: Crystal structure of anti-HIV llama VHH antibody A12
PDB Compounds: (A:) Llama VHH A12

SCOPe Domain Sequences for d3r0ma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d3r0ma_ b.1.1.1 (A:) automated matches {Llama (Lama glama) [TaxId: 9844]}
avqlqesggglvqaggslrlsctasgrisssydmgwfrqapgkerefvaaiswsggttdy
adsvkgrfaiskdnaknavylqmnslkpedtavyycaakwrplrysdypsnsdyydwgqg
tqvtvss

SCOPe Domain Coordinates for d3r0ma_:

Click to download the PDB-style file with coordinates for d3r0ma_.
(The format of our PDB-style files is described here.)

Timeline for d3r0ma_: