SCOP 1.73: Domain d1nfdc2: 1nfd C:118-213

Lineage for d1nfdc2 (1nfd C:118-213)

1. Root: SCOP 1.73

2. Class b: All beta proteins [48724] (165 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (27 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (4 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (23 proteins)

6. Protein T-cell antigen receptor [49125] (6 species)

7. Species Mouse (Mus musculus), alpha-chain [TaxId:10090] [49126] (7 PDB entries)

8. Domain d1nfdc2: 1nfd C:118-213 [21551]
   Other proteins in same PDB: d1nfda1, d1nfdb1, d1nfdc1, d1nfdd1, d1nfde1, d1nfde2, d1nfdf1, d1nfdf2, d1nfdg1, d1nfdg2, d1nfdh1, d1nfdh2
   complexed with nag

Details for d1nfdc2

PDB Entry: 1nfd, 2.8 Å

PDB Description: an alpha-beta t cell receptor (tcr) heterodimer in complex with an anti-tcr fab fragment derived from a mitogenic antibody

PDB Compounds: (C:) n15 alpha-beta T-cell receptor

SCOP Domain Sequences for d1nfdc2:

Sequence; same for both SEQRES and ATOM records:

>d1nfdc2 b.1.1.2 (C:118-213) T-cell antigen receptor {Mouse (Mus musculus), alpha-chain [TaxId: 10090]}
iqnpepavyqlkdprsqdstlclftdfdsqinvpktmesgtfitdktvldmkamdsksng
aiawsnqtsftcqdifketnatypssdvpc

Timeline for d1nfdc2:

• d1nfdc2 first appeared (with stable ids) in SCOP 1.55
  
• d1nfdc2 appears in SCOP 1.71
  
• d1nfdc2 appears in SCOP 1.75
  
• d1nfdc2 appears in the current release, SCOPe 2.08